KLF7 polyclonal antibody (A01)
  • KLF7 polyclonal antibody (A01)

KLF7 polyclonal antibody (A01)

Ref: AB-H00008609-A01
KLF7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant KLF7.
Información adicional
Size 50 uL
Gene Name KLF7
Gene Alias UKLF
Gene Description Kruppel-like factor 7 (ubiquitous)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVRSLISAHGRDVSGVLHEAMSSRGTTGNTQVQSPSNATTATGVFPGLTILPST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF7 (AAH12919, 1 a.a. ~ 230 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8609

Enviar uma mensagem


KLF7 polyclonal antibody (A01)

KLF7 polyclonal antibody (A01)