RGS20 monoclonal antibody (M04), clone 3E10
  • RGS20 monoclonal antibody (M04), clone 3E10

RGS20 monoclonal antibody (M04), clone 3E10

Ref: AB-H00008601-M04
RGS20 monoclonal antibody (M04), clone 3E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RGS20.
Información adicional
Size 100 ug
Gene Name RGS20
Gene Alias RGSZ1|ZGAP1
Gene Description regulator of G-protein signaling 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq NQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGS20 (NP_003693, 78 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8601
Clone Number 3E10
Iso type IgG2a Kappa

Enviar uma mensagem


RGS20 monoclonal antibody (M04), clone 3E10

RGS20 monoclonal antibody (M04), clone 3E10