RGS20 MaxPab rabbit polyclonal antibody (D01)
  • RGS20 MaxPab rabbit polyclonal antibody (D01)

RGS20 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008601-D01
RGS20 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RGS20 protein.
Información adicional
Size 100 uL
Gene Name RGS20
Gene Alias RGSZ1|ZGAP1
Gene Description regulator of G-protein signaling 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RGS20 (NP_003693.2, 1 a.a. ~ 241 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8601

Enviar uma mensagem


RGS20 MaxPab rabbit polyclonal antibody (D01)

RGS20 MaxPab rabbit polyclonal antibody (D01)