RGS20 purified MaxPab mouse polyclonal antibody (B01P)
  • RGS20 purified MaxPab mouse polyclonal antibody (B01P)

RGS20 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008601-B01P
RGS20 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RGS20 protein.
Información adicional
Size 50 ug
Gene Name RGS20
Gene Alias RGSZ1|ZGAP1
Gene Description regulator of G-protein signaling 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RGS20 (NP_003693.2, 1 a.a. ~ 241 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8601

Enviar uma mensagem


RGS20 purified MaxPab mouse polyclonal antibody (B01P)

RGS20 purified MaxPab mouse polyclonal antibody (B01P)