PRKRA monoclonal antibody (M02), clone 1G12
  • PRKRA monoclonal antibody (M02), clone 1G12

PRKRA monoclonal antibody (M02), clone 1G12

Ref: AB-H00008575-M02
PRKRA monoclonal antibody (M02), clone 1G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKRA.
Información adicional
Size 100 ug
Gene Name PRKRA
Gene Alias DYT16|HSD14|PACT|RAX
Gene Description protein kinase, interferon-inducible double stranded RNA dependent activator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq ANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKRA (NP_003681, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8575
Clone Number 1G12
Iso type IgG2a Kappa

Enviar uma mensagem


PRKRA monoclonal antibody (M02), clone 1G12

PRKRA monoclonal antibody (M02), clone 1G12