PRKRA polyclonal antibody (A02)
  • PRKRA polyclonal antibody (A02)

PRKRA polyclonal antibody (A02)

Ref: AB-H00008575-A02
PRKRA polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRKRA.
Información adicional
Size 50 uL
Gene Name PRKRA
Gene Alias DYT16|HSD14|PACT|RAX
Gene Description protein kinase, interferon-inducible double stranded RNA dependent activator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKRA (NP_003681, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8575

Enviar uma mensagem


PRKRA polyclonal antibody (A02)

PRKRA polyclonal antibody (A02)