KHSRP polyclonal antibody (A01)
  • KHSRP polyclonal antibody (A01)

KHSRP polyclonal antibody (A01)

Ref: AB-H00008570-A01
KHSRP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KHSRP.
Información adicional
Size 50 uL
Gene Name KHSRP
Gene Alias FBP2|FUBP2|KSRP|MGC99676
Gene Description KH-type splicing regulatory protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KHSRP (NP_003676, 151 a.a. ~ 239 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8570

Enviar uma mensagem


KHSRP polyclonal antibody (A01)

KHSRP polyclonal antibody (A01)