PDXK polyclonal antibody (A01)
  • PDXK polyclonal antibody (A01)

PDXK polyclonal antibody (A01)

Ref: AB-H00008566-A01
PDXK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDXK.
Información adicional
Size 50 uL
Gene Name PDXK
Gene Alias C21orf124|C21orf97|DKFZp566A071|FLJ31940|FLJ37311|MGC15873|MGC31754|MGC52346|PKH|PNK|PRED79
Gene Description pyridoxal (pyridoxine, vitamin B6) kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDXK (NP_003672, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8566

Enviar uma mensagem


PDXK polyclonal antibody (A01)

PDXK polyclonal antibody (A01)