DENR monoclonal antibody (M01), clone 1H3
  • DENR monoclonal antibody (M01), clone 1H3

DENR monoclonal antibody (M01), clone 1H3

Ref: AB-H00008562-M01
DENR monoclonal antibody (M01), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DENR.
Información adicional
Size 100 ug
Gene Name DENR
Gene Alias DRP|DRP1|SMAP-3
Gene Description density-regulated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DENR (NP_003668, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8562
Clone Number 1H3
Iso type IgG2a Kappa

Enviar uma mensagem


DENR monoclonal antibody (M01), clone 1H3

DENR monoclonal antibody (M01), clone 1H3