PIAS1 monoclonal antibody (M06), clone 4A4
  • PIAS1 monoclonal antibody (M06), clone 4A4

PIAS1 monoclonal antibody (M06), clone 4A4

Ref: AB-H00008554-M06
PIAS1 monoclonal antibody (M06), clone 4A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIAS1.
Información adicional
Size 100 ug
Gene Name PIAS1
Gene Alias DDXBP1|GBP|GU/RH-II|MGC141878|MGC141879|ZMIZ3
Gene Description protein inhibitor of activated STAT, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq LDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIAS1 (NP_057250, 543 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8554
Clone Number 4A4
Iso type IgG2b Kappa

Enviar uma mensagem


PIAS1 monoclonal antibody (M06), clone 4A4

PIAS1 monoclonal antibody (M06), clone 4A4