BHLHB2 polyclonal antibody (A01)
  • BHLHB2 polyclonal antibody (A01)

BHLHB2 polyclonal antibody (A01)

Ref: AB-H00008553-A01
BHLHB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BHLHB2.
Información adicional
Size 50 uL
Gene Name BHLHE40
Gene Alias BHLHB2|DEC1|FLJ99214|SHARP-2|STRA13|Stra14
Gene Description basic helix-loop-helix family, member e40
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BHLHB2 (NP_003661, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8553

Enviar uma mensagem


BHLHB2 polyclonal antibody (A01)

BHLHB2 polyclonal antibody (A01)