MAPKAPK5 monoclonal antibody (M01), clone 2D5
  • MAPKAPK5 monoclonal antibody (M01), clone 2D5

MAPKAPK5 monoclonal antibody (M01), clone 2D5

Ref: AB-H00008550-M01
MAPKAPK5 monoclonal antibody (M01), clone 2D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPKAPK5.
Información adicional
Size 100 ug
Gene Name MAPKAPK5
Gene Alias PRAK
Gene Description mitogen-activated protein kinase-activated protein kinase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq KDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPKAPK5 (AAH47284, 371 a.a. ~ 471 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8550
Clone Number 2D5
Iso type IgG1 Kappa

Enviar uma mensagem


MAPKAPK5 monoclonal antibody (M01), clone 2D5

MAPKAPK5 monoclonal antibody (M01), clone 2D5