BLZF1 polyclonal antibody (A01)
  • BLZF1 polyclonal antibody (A01)

BLZF1 polyclonal antibody (A01)

Ref: AB-H00008548-A01
BLZF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BLZF1.
Información adicional
Size 50 uL
Gene Name BLZF1
Gene Alias GOLGIN-45|JEM-1|JEM-1s|JEM1|MGC22497
Gene Description basic leucine zipper nuclear factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BLZF1 (NP_003657, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8548

Enviar uma mensagem


BLZF1 polyclonal antibody (A01)

BLZF1 polyclonal antibody (A01)