FCN3 polyclonal antibody (A01)
  • FCN3 polyclonal antibody (A01)

FCN3 polyclonal antibody (A01)

Ref: AB-H00008547-A01
FCN3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant FCN3.
Información adicional
Size 50 uL
Gene Name FCN3
Gene Alias FCNH|HAKA1|MGC22543
Gene Description ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FCN3 (AAH20731, 1 a.a. ~ 288 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8547

Enviar uma mensagem


FCN3 polyclonal antibody (A01)

FCN3 polyclonal antibody (A01)