CGGBP1 monoclonal antibody (M02), clone 1D11
  • CGGBP1 monoclonal antibody (M02), clone 1D11

CGGBP1 monoclonal antibody (M02), clone 1D11

Ref: AB-H00008545-M02
CGGBP1 monoclonal antibody (M02), clone 1D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CGGBP1.
Información adicional
Size 100 ug
Gene Name CGGBP1
Gene Alias CGGBP|p20-CGGBP
Gene Description CGG triplet repeat binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq ISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CGGBP1 (NP_003654, 58 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8545
Clone Number 1D11
Iso type IgG1 Kappa

Enviar uma mensagem


CGGBP1 monoclonal antibody (M02), clone 1D11

CGGBP1 monoclonal antibody (M02), clone 1D11