PIR monoclonal antibody (M03), clone 4D1
  • PIR monoclonal antibody (M03), clone 4D1

PIR monoclonal antibody (M03), clone 4D1

Ref: AB-H00008544-M03
PIR monoclonal antibody (M03), clone 4D1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PIR.
Información adicional
Size 100 ug
Gene Name PIR
Gene Alias -
Gene Description pirin (iron-binding nuclear protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIR (AAH02517, 1 a.a. ~ 290 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8544
Clone Number 4D1
Iso type IgG2a Kappa

Enviar uma mensagem


PIR monoclonal antibody (M03), clone 4D1

PIR monoclonal antibody (M03), clone 4D1