LMO4 polyclonal antibody (A01)
  • LMO4 polyclonal antibody (A01)

LMO4 polyclonal antibody (A01)

Ref: AB-H00008543-A01
LMO4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant LMO4.
Información adicional
Size 50 uL
Gene Name LMO4
Gene Alias -
Gene Description LIM domain only 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LMO4 (AAH17673, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8543

Enviar uma mensagem


LMO4 polyclonal antibody (A01)

LMO4 polyclonal antibody (A01)