COPS3 monoclonal antibody (M02A), clone 2D10
  • COPS3 monoclonal antibody (M02A), clone 2D10

COPS3 monoclonal antibody (M02A), clone 2D10

Ref: AB-H00008533-M02A
COPS3 monoclonal antibody (M02A), clone 2D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COPS3.
Información adicional
Size 200 uL
Gene Name COPS3
Gene Alias CSN3|SGN3
Gene Description COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COPS3 (NP_003644, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 8533
Clone Number 2D10
Iso type IgG2a Kappa

Enviar uma mensagem


COPS3 monoclonal antibody (M02A), clone 2D10

COPS3 monoclonal antibody (M02A), clone 2D10