DDO purified MaxPab rabbit polyclonal antibody (D01P)
  • DDO purified MaxPab rabbit polyclonal antibody (D01P)

DDO purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008528-D01P
DDO purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DDO protein.
Información adicional
Size 100 ug
Gene Name DDO
Gene Alias DASOX|DDO-1|DDO-2|FLJ45203
Gene Description D-aspartate oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRPARHWETRFGARDFGGFQDCFFRDRLMDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDO (NP_003640.2, 1 a.a. ~ 369 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8528

Enviar uma mensagem


DDO purified MaxPab rabbit polyclonal antibody (D01P)

DDO purified MaxPab rabbit polyclonal antibody (D01P)