GAS7 purified MaxPab mouse polyclonal antibody (B01P)
  • GAS7 purified MaxPab mouse polyclonal antibody (B01P)

GAS7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008522-B01P
GAS7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GAS7 protein.
Información adicional
Size 50 ug
Gene Name GAS7
Gene Alias KIAA0394|MGC1348|MLL/GAS7
Gene Description growth arrest-specific 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKPGMVPPPPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GAS7 (NP_958836.1, 1 a.a. ~ 416 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8522

Enviar uma mensagem


GAS7 purified MaxPab mouse polyclonal antibody (B01P)

GAS7 purified MaxPab mouse polyclonal antibody (B01P)