GCM1 monoclonal antibody (M02), clone 4C11
  • GCM1 monoclonal antibody (M02), clone 4C11

GCM1 monoclonal antibody (M02), clone 4C11

Ref: AB-H00008521-M02
GCM1 monoclonal antibody (M02), clone 4C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GCM1.
Información adicional
Size 100 ug
Gene Name GCM1
Gene Alias GCMA|hGCMa
Gene Description glial cells missing homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8521
Clone Number 4C11
Iso type IgG2b Kappa

Enviar uma mensagem


GCM1 monoclonal antibody (M02), clone 4C11

GCM1 monoclonal antibody (M02), clone 4C11