IFITM1 monoclonal antibody (M01), clone 1F8
  • IFITM1 monoclonal antibody (M01), clone 1F8

IFITM1 monoclonal antibody (M01), clone 1F8

Ref: AB-H00008519-M01
IFITM1 monoclonal antibody (M01), clone 1F8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant IFITM1.
Información adicional
Size 100 ug
Gene Name IFITM1
Gene Alias 9-27|CD225|IFI17|LEU13
Gene Description interferon induced transmembrane protein 1 (9-27)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFITM1 (AAH00897, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8519
Clone Number 1F8
Iso type IgG2b Kappa

Enviar uma mensagem


IFITM1 monoclonal antibody (M01), clone 1F8

IFITM1 monoclonal antibody (M01), clone 1F8