IFITM1 purified MaxPab rabbit polyclonal antibody (D01P)
  • IFITM1 purified MaxPab rabbit polyclonal antibody (D01P)

IFITM1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008519-D01P
IFITM1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFITM1 protein.
Información adicional
Size 100 ug
Gene Name IFITM1
Gene Alias 9-27|CD225|IFI17|LEU13
Gene Description interferon induced transmembrane protein 1 (9-27)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFITM1 (AAH00897.1, 1 a.a. ~ 125 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8519

Enviar uma mensagem


IFITM1 purified MaxPab rabbit polyclonal antibody (D01P)

IFITM1 purified MaxPab rabbit polyclonal antibody (D01P)