IKBKAP monoclonal antibody (M03), clone 6G9
  • IKBKAP monoclonal antibody (M03), clone 6G9

IKBKAP monoclonal antibody (M03), clone 6G9

Ref: AB-H00008518-M03
IKBKAP monoclonal antibody (M03), clone 6G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IKBKAP.
Información adicional
Size 100 ug
Gene Name IKBKAP
Gene Alias DKFZp781H1425|DYS|ELP1|FD|FLJ12497|IKAP|IKI3|TOT1
Gene Description inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IKBKAP (NP_003631, 1242 a.a. ~ 1331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8518
Clone Number 6G9
Iso type IgG1 Kappa

Enviar uma mensagem


IKBKAP monoclonal antibody (M03), clone 6G9

IKBKAP monoclonal antibody (M03), clone 6G9