IKBKG polyclonal antibody (A01)
  • IKBKG polyclonal antibody (A01)

IKBKG polyclonal antibody (A01)

Ref: AB-H00008517-A01
IKBKG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IKBKG.
Información adicional
Size 50 uL
Gene Name IKBKG
Gene Alias AMCBX1|FIP-3|FIP3|Fip3p|IKK-gamma|IP|IP1|IP2|IPD2|NEMO
Gene Description inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IKBKG (NP_003630, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8517

Enviar uma mensagem


IKBKG polyclonal antibody (A01)

IKBKG polyclonal antibody (A01)