ITGA8 monoclonal antibody (M02), clone 2G7
  • ITGA8 monoclonal antibody (M02), clone 2G7

ITGA8 monoclonal antibody (M02), clone 2G7

Ref: AB-H00008516-M02
ITGA8 monoclonal antibody (M02), clone 2G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGA8.
Información adicional
Size 100 ug
Gene Name ITGA8
Gene Alias -
Gene Description integrin, alpha 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA8 (NP_003629, 836 a.a. ~ 935 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8516
Clone Number 2G7
Iso type IgG2b Kappa

Enviar uma mensagem


ITGA8 monoclonal antibody (M02), clone 2G7

ITGA8 monoclonal antibody (M02), clone 2G7