ITGA8 polyclonal antibody (A01)
  • ITGA8 polyclonal antibody (A01)

ITGA8 polyclonal antibody (A01)

Ref: AB-H00008516-A01
ITGA8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGA8.
Información adicional
Size 50 uL
Gene Name ITGA8
Gene Alias -
Gene Description integrin, alpha 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA8 (NP_003629, 836 a.a. ~ 935 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8516

Enviar uma mensagem


ITGA8 polyclonal antibody (A01)

ITGA8 polyclonal antibody (A01)