ITGA10 purified MaxPab mouse polyclonal antibody (B01P)
  • ITGA10 purified MaxPab mouse polyclonal antibody (B01P)

ITGA10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008515-B01P
ITGA10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ITGA10 protein.
Información adicional
Size 50 ug
Gene Name ITGA10
Gene Alias PRO827
Gene Description integrin, alpha 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGAPWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGGFMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYPWSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREGRETKTAQAIMVACTE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITGA10 (AAI60008.1, 1 a.a. ~ 1167 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8515

Enviar uma mensagem


ITGA10 purified MaxPab mouse polyclonal antibody (B01P)

ITGA10 purified MaxPab mouse polyclonal antibody (B01P)