ENC1 monoclonal antibody (M03), clone 3C10
  • ENC1 monoclonal antibody (M03), clone 3C10

ENC1 monoclonal antibody (M03), clone 3C10

Ref: AB-H00008507-M03
ENC1 monoclonal antibody (M03), clone 3C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ENC1.
Información adicional
Size 100 ug
Gene Name ENC1
Gene Alias CCL28|ENC-1|FLJ39259|KLHL35|KLHL37|NRPB|PIG10|TP53I10
Gene Description ectodermal-neural cortex (with BTB-like domain)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENC1 (NP_003624, 17 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8507
Clone Number 3C10
Iso type IgG1 Kappa

Enviar uma mensagem


ENC1 monoclonal antibody (M03), clone 3C10

ENC1 monoclonal antibody (M03), clone 3C10