ENC1 polyclonal antibody (A01)
  • ENC1 polyclonal antibody (A01)

ENC1 polyclonal antibody (A01)

Ref: AB-H00008507-A01
ENC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ENC1.
Información adicional
Size 50 uL
Gene Name ENC1
Gene Alias CCL28|ENC-1|FLJ39259|KLHL35|KLHL37|NRPB|PIG10|TP53I10
Gene Description ectodermal-neural cortex (with BTB-like domain)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENC1 (NP_003624, 17 a.a. ~ 98 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8507

Enviar uma mensagem


ENC1 polyclonal antibody (A01)

ENC1 polyclonal antibody (A01)