PKP4 monoclonal antibody (M06), clone 4H7
  • PKP4 monoclonal antibody (M06), clone 4H7

PKP4 monoclonal antibody (M06), clone 4H7

Ref: AB-H00008502-M06
PKP4 monoclonal antibody (M06), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PKP4.
Información adicional
Size 100 ug
Gene Name PKP4
Gene Alias FLJ31261|FLJ42243|p0071
Gene Description plakophilin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PKP4 (NP_001005476, 12 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8502
Clone Number 4H7
Iso type IgG2a Kappa

Enviar uma mensagem


PKP4 monoclonal antibody (M06), clone 4H7

PKP4 monoclonal antibody (M06), clone 4H7