PKP4 polyclonal antibody (A01)
  • PKP4 polyclonal antibody (A01)

PKP4 polyclonal antibody (A01)

Ref: AB-H00008502-A01
PKP4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PKP4.
Información adicional
Size 50 uL
Gene Name PKP4
Gene Alias FLJ31261|FLJ42243|p0071
Gene Description plakophilin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PKP4 (NP_001005476, 12 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8502

Enviar uma mensagem


PKP4 polyclonal antibody (A01)

PKP4 polyclonal antibody (A01)