PPM1D monoclonal antibody (M01), clone 4D1
  • PPM1D monoclonal antibody (M01), clone 4D1

PPM1D monoclonal antibody (M01), clone 4D1

Ref: AB-H00008493-M01
PPM1D monoclonal antibody (M01), clone 4D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPM1D.
Información adicional
Size 100 ug
Gene Name PPM1D
Gene Alias PP2C-DELTA|WIP1
Gene Description protein phosphatase 1D magnesium-dependent, delta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPM1D (NP_003611, 496 a.a. ~ 605 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8493
Clone Number 4D1
Iso type IgG1 Kappa

Enviar uma mensagem


PPM1D monoclonal antibody (M01), clone 4D1

PPM1D monoclonal antibody (M01), clone 4D1