RGS5 monoclonal antibody (M01), clone 4E12
  • RGS5 monoclonal antibody (M01), clone 4E12

RGS5 monoclonal antibody (M01), clone 4E12

Ref: AB-H00008490-M01
RGS5 monoclonal antibody (M01), clone 4E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RGS5.
Información adicional
Size 100 ug
Gene Name RGS5
Gene Alias MST092|MST106|MST129|MSTP032|MSTP092|MSTP106|MSTP129
Gene Description regulator of G-protein signaling 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGS5 (NM_003617, 94 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8490
Clone Number 4E12
Iso type IgG2b Kappa

Enviar uma mensagem


RGS5 monoclonal antibody (M01), clone 4E12

RGS5 monoclonal antibody (M01), clone 4E12