RGS5 purified MaxPab mouse polyclonal antibody (B01P)
  • RGS5 purified MaxPab mouse polyclonal antibody (B01P)

RGS5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008490-B01P
RGS5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RGS5 protein.
Información adicional
Size 50 ug
Gene Name RGS5
Gene Alias MST092|MST106|MST129|MSTP032|MSTP092|MSTP106|MSTP129
Gene Description regulator of G-protein signaling 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RGS5 (NP_003608.1, 1 a.a. ~ 181 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8490

Enviar uma mensagem


RGS5 purified MaxPab mouse polyclonal antibody (B01P)

RGS5 purified MaxPab mouse polyclonal antibody (B01P)