SIP1 purified MaxPab mouse polyclonal antibody (B01P)
  • SIP1 purified MaxPab mouse polyclonal antibody (B01P)

SIP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008487-B01P
SIP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIP1 protein.
Información adicional
Size 50 ug
Gene Name SIP1
Gene Alias GEMIN2|SIP1-delta
Gene Description survival of motor neuron protein interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIP1 (NP_003607.1, 1 a.a. ~ 280 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8487

Enviar uma mensagem


SIP1 purified MaxPab mouse polyclonal antibody (B01P)

SIP1 purified MaxPab mouse polyclonal antibody (B01P)