CILP monoclonal antibody (M01), clone 2C5
  • CILP monoclonal antibody (M01), clone 2C5

CILP monoclonal antibody (M01), clone 2C5

Ref: AB-H00008483-M01
CILP monoclonal antibody (M01), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CILP.
Información adicional
Size 100 ug
Gene Name CILP
Gene Alias CILP-1|HsT18872
Gene Description cartilage intermediate layer protein, nucleotide pyrophosphohydrolase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CILP (NP_003604, 129 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8483
Clone Number 2C5
Iso type IgG1 Kappa

Enviar uma mensagem


CILP monoclonal antibody (M01), clone 2C5

CILP monoclonal antibody (M01), clone 2C5