CILP polyclonal antibody (A01)
  • CILP polyclonal antibody (A01)

CILP polyclonal antibody (A01)

Ref: AB-H00008483-A01
CILP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CILP.
Información adicional
Size 50 uL
Gene Name CILP
Gene Alias CILP-1|HsT18872
Gene Description cartilage intermediate layer protein, nucleotide pyrophosphohydrolase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CILP (NP_003604, 129 a.a. ~ 226 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8483

Enviar uma mensagem


CILP polyclonal antibody (A01)

CILP polyclonal antibody (A01)