SORBS2 purified MaxPab mouse polyclonal antibody (B01P)
  • SORBS2 purified MaxPab mouse polyclonal antibody (B01P)

SORBS2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008470-B01P
SORBS2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SORBS2 protein.
Información adicional
Size 50 ug
Gene Name SORBS2
Gene Alias ARGBP2|FLJ93447|KIAA0777|PRO0618
Gene Description sorbin and SH3 domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPASLYQSSIDRSLERPMSSASMASDFRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SORBS2 (NP_066547.1, 1 a.a. ~ 1100 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8470

Enviar uma mensagem


SORBS2 purified MaxPab mouse polyclonal antibody (B01P)

SORBS2 purified MaxPab mouse polyclonal antibody (B01P)