SMARCA5 monoclonal antibody (M02), clone 3F4
  • SMARCA5 monoclonal antibody (M02), clone 3F4

SMARCA5 monoclonal antibody (M02), clone 3F4

Ref: AB-H00008467-M02
SMARCA5 monoclonal antibody (M02), clone 3F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMARCA5.
Información adicional
Size 100 ug
Gene Name SMARCA5
Gene Alias ISWI|SNF2H|WCRF135|hISWI|hSNF2H
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCA5 (NP_003592, 59 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8467
Clone Number 3F4
Iso type IgG2a Kappa

Enviar uma mensagem


SMARCA5 monoclonal antibody (M02), clone 3F4

SMARCA5 monoclonal antibody (M02), clone 3F4