TEAD2 purified MaxPab mouse polyclonal antibody (B01P)
  • TEAD2 purified MaxPab mouse polyclonal antibody (B01P)

TEAD2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008463-B01P
TEAD2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TEAD2 protein.
Información adicional
Size 50 ug
Gene Name TEAD2
Gene Alias ETF|TEF-4|TEF4
Gene Description TEA domain family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHIS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TEAD2 (NP_003589.1, 1 a.a. ~ 447 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8463

Enviar uma mensagem


TEAD2 purified MaxPab mouse polyclonal antibody (B01P)

TEAD2 purified MaxPab mouse polyclonal antibody (B01P)