KLF11 monoclonal antibody (M01), clone 8F4 View larger

Mouse monoclonal antibody raised against a partial recombinant KLF11.

AB-H00008462-M01

New product

KLF11 monoclonal antibody (M01), clone 8F4

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name KLF11
Gene Alias FKLF|FKLF1|MODY7|TIEG2|Tieg3
Gene Description Kruppel-like factor 11
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8462
Clone Number 8F4
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant KLF11.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant KLF11.

Mouse monoclonal antibody raised against a partial recombinant KLF11.