KLF11 monoclonal antibody (M01), clone 8F4
  • KLF11 monoclonal antibody (M01), clone 8F4

KLF11 monoclonal antibody (M01), clone 8F4

Ref: AB-H00008462-M01
KLF11 monoclonal antibody (M01), clone 8F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLF11.
Información adicional
Size 100 ug
Gene Name KLF11
Gene Alias FKLF|FKLF1|MODY7|TIEG2|Tieg3
Gene Description Kruppel-like factor 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8462
Clone Number 8F4
Iso type IgG2a Kappa

Enviar uma mensagem


KLF11 monoclonal antibody (M01), clone 8F4

KLF11 monoclonal antibody (M01), clone 8F4