TTF2 monoclonal antibody (M12), clone 2B6
  • TTF2 monoclonal antibody (M12), clone 2B6

TTF2 monoclonal antibody (M12), clone 2B6

Ref: AB-H00008458-M12
TTF2 monoclonal antibody (M12), clone 2B6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TTF2.
Información adicional
Size 100 ug
Gene Name TTF2
Gene Alias HuF2
Gene Description transcription termination factor, RNA polymerase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QFPDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQLKQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSNSQVPQQSHFTKTTTGPPHLVPPQPLPRRGTQPVGSLELK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTF2 (NP_003585, 385 a.a. ~ 509 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8458
Clone Number 2B6
Iso type IgG2a Kappa

Enviar uma mensagem


TTF2 monoclonal antibody (M12), clone 2B6

TTF2 monoclonal antibody (M12), clone 2B6