DYRK2 monoclonal antibody (M02), clone 6E2
  • DYRK2 monoclonal antibody (M02), clone 6E2

DYRK2 monoclonal antibody (M02), clone 6E2

Ref: AB-H00008445-M02
DYRK2 monoclonal antibody (M02), clone 6E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DYRK2.
Información adicional
Size 100 ug
Gene Name DYRK2
Gene Alias FLJ21217|FLJ21365
Gene Description dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DYRK2 (AAH05809, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8445
Clone Number 6E2
Iso type IgG3 Kappa

Enviar uma mensagem


DYRK2 monoclonal antibody (M02), clone 6E2

DYRK2 monoclonal antibody (M02), clone 6E2