RAD54L polyclonal antibody (A01)
  • RAD54L polyclonal antibody (A01)

RAD54L polyclonal antibody (A01)

Ref: AB-H00008438-A01
RAD54L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAD54L.
Información adicional
Size 50 uL
Gene Name RAD54L
Gene Alias HR54|RAD54A|hHR54|hRAD54
Gene Description RAD54-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAD54L (NP_003570, 638 a.a. ~ 747 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8438

Enviar uma mensagem


RAD54L polyclonal antibody (A01)

RAD54L polyclonal antibody (A01)