ANXA9 purified MaxPab mouse polyclonal antibody (B01P)
  • ANXA9 purified MaxPab mouse polyclonal antibody (B01P)

ANXA9 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008416-B01P
ANXA9 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ANXA9 protein.
Información adicional
Size 50 ug
Gene Name ANXA9
Gene Alias ANX31
Gene Description annexin A9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAEGPSREETWVPVFTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQVALL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANXA9 (AAH05830.2, 1 a.a. ~ 338 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8416

Enviar uma mensagem


ANXA9 purified MaxPab mouse polyclonal antibody (B01P)

ANXA9 purified MaxPab mouse polyclonal antibody (B01P)