EEA1 monoclonal antibody (M03), clone 2G2
  • EEA1 monoclonal antibody (M03), clone 2G2

EEA1 monoclonal antibody (M03), clone 2G2

Ref: AB-H00008411-M03
EEA1 monoclonal antibody (M03), clone 2G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EEA1.
Información adicional
Size 100 ug
Gene Name EEA1
Gene Alias MST105|MSTP105|ZFYVE2
Gene Description early endosome antigen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EEA1 (NP_003557, 1312 a.a. ~ 1411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8411
Clone Number 2G2
Iso type IgG1 Kappa

Enviar uma mensagem


EEA1 monoclonal antibody (M03), clone 2G2

EEA1 monoclonal antibody (M03), clone 2G2