EEA1 polyclonal antibody (A01)
  • EEA1 polyclonal antibody (A01)

EEA1 polyclonal antibody (A01)

Ref: AB-H00008411-A01
EEA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EEA1.
Información adicional
Size 50 uL
Gene Name EEA1
Gene Alias MST105|MSTP105|ZFYVE2
Gene Description early endosome antigen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EEA1 (NP_003557, 1312 a.a. ~ 1411 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8411

Enviar uma mensagem


EEA1 polyclonal antibody (A01)

EEA1 polyclonal antibody (A01)