ULK1 monoclonal antibody (M01), clone 2H8
  • ULK1 monoclonal antibody (M01), clone 2H8

ULK1 monoclonal antibody (M01), clone 2H8

Ref: AB-H00008408-M01
ULK1 monoclonal antibody (M01), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ULK1.
Información adicional
Size 100 ug
Gene Name ULK1
Gene Alias ATG1|FLJ38455|UNC51|Unc51.1
Gene Description unc-51-like kinase 1 (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ULK1 (NP_003556.1, 602 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8408
Clone Number 2H8
Iso type IgG1 Kappa

Enviar uma mensagem


ULK1 monoclonal antibody (M01), clone 2H8

ULK1 monoclonal antibody (M01), clone 2H8