ULK1 polyclonal antibody (A01)
  • ULK1 polyclonal antibody (A01)

ULK1 polyclonal antibody (A01)

Ref: AB-H00008408-A01
ULK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ULK1.
Información adicional
Size 50 uL
Gene Name ULK1
Gene Alias ATG1|FLJ38455|UNC51|Unc51.1
Gene Description unc-51-like kinase 1 (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ULK1 (NP_003556.1, 602 a.a. ~ 715 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8408

Enviar uma mensagem


ULK1 polyclonal antibody (A01)

ULK1 polyclonal antibody (A01)